PDB entry 6d8k

View 6d8k on RCSB PDB site
Description: Bacteroides multiple species beta-glucuronidase
Class: hydrolase
Keywords: glycosyl hydrolase, beta-glucuronidase, HYDROLASE
Deposited on 2018-04-26, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase family 2, sugar binding domain protein
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: HMPREF2532_04191
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A139KTC9 (26-566)
      • expression tag (24-25)
      • expression tag (567-593)
  • Chain 'B':
    Compound: Glycosyl hydrolase family 2, sugar binding domain protein
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: HMPREF2532_04191
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A139KTC9 (26-566)
      • expression tag (24-25)
      • expression tag (567-594)
  • Chain 'C':
    Compound: Glycosyl hydrolase family 2, sugar binding domain protein
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: HMPREF2532_04191
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A139KTC9 (26-566)
      • expression tag (25)
      • expression tag (567-593)
  • Chain 'D':
    Compound: Glycosyl hydrolase family 2, sugar binding domain protein
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: HMPREF2532_04191
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A139KTC9 (26-566)
      • expression tag (25)
      • expression tag (567-589)
    Domains in SCOPe 2.07: d6d8kd1, d6d8kd2, d6d8kd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d8kD (D:)
    mqirkktivcmllfilfvgnavaqqnitnvygrdirslngkwnaiidlydqgrgmkvyrn
    qspkgntdfyeysfqgglrlnvpgdwnsqtpelkyyegtvwyarhfdakrlthkrqflyf
    gavsyrcrvylngaeigsheggftpfqievtdllnegenfiaievnnrrtkdaipamsfd
    wwnyggitrdvllvttpqtyledyfiqldkespnrmiakvalsdkkagekitvsipelkt
    sidmltdaegkaetvfnikklerwssenpklyevivssandrveeqigfrnitvkgtdiy
    lngkptfmcsisfheeipqrmgrafseadaamllneakalgvnmirlahypqneytvrla
    ekmgfilwqeipvwqgidftnnntrkkaqrmlsemikrdqnrcavgywgianetqpskar
    nefltslletgkqldttrlyvaafdlvrfnrekkrfvmedsftsqldvvavnkymgwyhp
    wpiepenavwevipdkpliisefggealygqsgdenvasswseeyqarlyrdnirmfdni
    pnlrgvspwilfdfrspfrfhptnqdgwnrkglvsdqgirkkawylmreyyktkfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8kD (D:)
    nitnvygrdirslngkwnaiidlydqgrgmkvyrnqspkgntdfyeysfqgglrlnvpgd
    wnsqtpelkyyegtvwyarhfdakrlthkrqflyfgavsyrcrvylngaeigsheggftp
    fqievtdllnegenfiaievnnrrtkdaipamsfdwwnyggitrdvllvttpqtyledys
    fheeipqrmgrafseadaamllneakalgvnmirlahypqneytvrlaekmgfilwqeip
    vwqgidftnnntrkkaqrmlsemikrdqnrcavgywgianetletgkqldttrlyvaaff
    ggealygqsgdenvasswseeyqarlyrdnispwilfdfrspfrfhptnqdgwnrkglvs
    dqgirkkawylmrey