PDB entry 6d5x

View 6d5x on RCSB PDB site
Description: Structure of Human ATP:Cobalamin Adenosyltransferase bound to ATP, Adenosylcobalamin, and Triphosphate
Class: transferase
Keywords: B12, metabolism, adenosyltransferase, TRANSFERASE
Deposited on 2018-04-19, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MMAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d5xa_
  • Chain 'B':
    Compound: Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MMAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d5xb_
  • Chain 'C':
    Compound: Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MMAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d5xc_
  • Heterogens: 3PO, 5AD, ATP, MG, B12, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d5xA (A:)
    mpkiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeel
    qkiqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilps
    ggkissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnq
    ekiymkndpsaesegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5xA (A:)
    ddqvfeavgttdelssaigfalelvtekghtfaeelqkiqctlqdvgsalatkyttfkag
    pileleqwidkytsqlppltafilpsggkissalhfcravcrraerrvvplvqmgetdan
    vakflnrlsdylftlaryaamkegnqekiym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d5xB (B:)
    mpkiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeel
    qkiqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilps
    ggkissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnq
    ekiymkndpsaesegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5xB (B:)
    kiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqk
    iqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsgg
    kissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqek
    iym
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d5xC (C:)
    mpkiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeel
    qkiqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilps
    ggkissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnq
    ekiymkndpsaesegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5xC (C:)
    ktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqkiqct
    lqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsggkiss
    alhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqekiymk
    n