PDB entry 6d57

View 6d57 on RCSB PDB site
Description: Campylobacter jejuni ferric uptake regulator S1 metalated
Class: metal transport
Keywords: Fur, ferric uptake regulator, Campylobacter jejuni, metalloregulator, METAL TRANSPORT
Deposited on 2018-04-19, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: fur, A0L11_08850, A8118_04250, AJ878_05735, AJY51_02300, AJY53_01130, AJY73_06030, B5Y32_02790, B5Z71_06080, BD28_01920, BKM79_01965, CRM98_01485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d57a_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: fur, A0L11_08850, A8118_04250, AJ878_05735, AJY51_02300, AJY53_01130, AJY73_06030, B5Y32_02790, B5Z71_06080, BD28_01920, BKM79_01965, CRM98_01485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d57b1, d6d57b2
  • Heterogens: GOL, FMT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d57A (A:)
    gamgmlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqa
    epdlnvgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefen
    piierqqaliakehgfkltghlmqlygvcgdcnnqkakvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d57A (A:)
    ienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdnvg
    iatvyrtlnlleeaemvtsisfggkkyelankphhdhmickncgkiiefenpiierqqal
    iakehgfkltghlmqlygvcgdcn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d57B (B:)
    gamgmlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqa
    epdlnvgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefen
    piierqqaliakehgfkltghlmqlygvcgdcnnqkakvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d57B (B:)
    mgmlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaep
    dlnvgiatvyrtlnlleeaemvtsiskkyelankphhdhmickncgkiiefenpiierqq
    aliakehgfkltghlmqlygvcgdcnnqkak