PDB entry 6d4p

View 6d4p on RCSB PDB site
Description: Ube2D1 in complex with ubiquitin variant Ubv.D1.1
Class: transferase
Keywords: Ubiquitin, Ubiquitin conjugating enzyme, Ubiquitin variant, TRANSFERASE
Deposited on 2018-04-18, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D1, SFT, UBC5A, UBCH5, UBCH5A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51668 (2-148)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6d4pa1, d6d4pa2
  • Chain 'C':
    Compound: Ubiquitin Variant Ubv.D1.1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59EM9 (12-End)
      • expression tag (10-11)
      • engineered mutation (18-20)
      • engineered mutation (75-76)
      • engineered mutation (79)
      • engineered mutation (81-83)
    Domains in SCOPe 2.08: d6d4pc1, d6d4pc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d4pA (A:)
    gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
    dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
    lvpdiaqiyksdkekynrharewtqkyam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d4pC (C:)
    gaggdykddddkmqifvkkfwgktitlevepsdtienvkakiqdkegippdqqrlifagk
    qledgrtlsdyniqkkftlylayglrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4pC (C:)
    dkmqifvkkfwgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkkftlylayg