PDB entry 6d48

View 6d48 on RCSB PDB site
Description: Cell Surface Receptor
Class: immune system
Keywords: Sialic Acid Binding, Transmembrane, Receptor, Siglec, IMMUNE SYSTEM
Deposited on 2018-04-17, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Myeloid cell surface antigen CD33
    Species: Homo sapiens [TaxId:9606]
    Gene: CD33, SIGLEC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d48e_
  • Chain 'F':
    Compound: Myeloid cell surface antigen CD33
    Species: Homo sapiens [TaxId:9606]
    Gene: CD33, SIGLEC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d48f_
  • Chain 'G':
    Compound: Myeloid cell surface antigen CD33
    Species: Homo sapiens [TaxId:9606]
    Gene: CD33, SIGLEC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d48g_
  • Chain 'H':
    Compound: Myeloid cell surface antigen CD33
    Species: Homo sapiens [TaxId:9606]
    Gene: CD33, SIGLEC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d48h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d48E (E:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d48E (E:)
    dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
    ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
    vtdlt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d48F (F:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d48F (F:)
    dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
    ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
    vtdlt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6d48G (G:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d48G (G:)
    dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
    ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
    vtdl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6d48H (H:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d48H (H:)
    dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
    ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
    vtdl