PDB entry 6d45

View 6d45 on RCSB PDB site
Description: L89S Mutant of FeBMb Sperm Whale Myoglobin
Class: oxygen storage
Keywords: nitric oxide reductase, NOR, biosynthetic, HCO, METAL BINDING PROTEIN, OXYGEN STORAGE
Deposited on 2018-04-17, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • engineered mutation (42)
      • engineered mutation (67)
      • engineered mutation (88)
    Domains in SCOPe 2.07: d6d45a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d45A (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
    lkkhgvteltalgailkkkghheaelkpsaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg