PDB entry 6d3f

View 6d3f on RCSB PDB site
Description: Crystal Structure of the PTP epsilon D2 domain
Class: hydrolase
Keywords: phosphatase, HYDROLASE
Deposited on 2018-04-16, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-type tyrosine-protein phosphatase epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3fa_
  • Chain 'B':
    Compound: receptor-type tyrosine-protein phosphatase epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3fA (A:)
    ggggleeefrkltnvrimkenmrtgnlpanmkkarviqiipydfnrvilsmkrgqeytdy
    inasfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywp
    tegsvthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpeigip
    aegkgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqa
    vkslrlqrphmvqtleqyefcykvvqdfidifsdyanfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3fA (A:)
    gleeefrkltnvrimkenmrtgnlpanmkkarviqiipydfnrvilsmkrgqeytdyina
    sfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywpteg
    svthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpeigipaeg
    kgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqavks
    lrlqrphmvqtleqyefcykvvqdfidifsdyanf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3fB (B:)
    ggggleeefrkltnvrimkenmrtgnlpanmkkarviqiipydfnrvilsmkrgqeytdy
    inasfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywp
    tegsvthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpeigip
    aegkgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqa
    vkslrlqrphmvqtleqyefcykvvqdfidifsdyanfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3fB (B:)
    gleeefrkltnvrimkenmrtgnlpanmkkarviqiipydfnrvilsmkrgqeytdyina
    sfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywpteg
    svthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpeigipaeg
    kgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqavks
    lrlqrphmvqtleqyefcykvvqdfidi