PDB entry 6d2q

View 6d2q on RCSB PDB site
Description: Crystal structure of the FERM domain of zebrafish FARP1
Class: signaling protein
Keywords: membrane targeting, SIGNALING PROTEIN
Deposited on 2018-04-13, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
    Species: Danio rerio [TaxId:7955]
    Gene: farp1, si:ch211-235f1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d2qa1, d6d2qa2, d6d2qa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d2qA (A:)
    sgrqisirvqmlddtqevfevsqrapgkalfdlvcshlnlvegdyfglefqdqrkmivwl
    dllkpilkqirrpkniilrfvvkffppdhtqlleeltrylfalqikhdlacgrltcness
    aallvahivqseigdfdevqckqhllnnkyipeqdtlmdkiigyhrkhvgqtpaesdyql
    leiarrlemygvrlhpakdregtrlslavahsgvlvfqghtkinafnwskvrklsfkrkr
    fliklrpdlnsncqdtlefmmgsrdcckvfwkicveyhaffrlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d2qA (A:)
    grqisirvqmlddtqevfevsqrapgkalfdlvcshlnlvegdyfglefqdqrkmivwld
    llkpilkqirrpkniilrfvvkffppdhtqlleeltrylfalqikhdlacgrltcnessa
    allvahivqseigdfdevqckqhllnnkyipeqdtlmdkiigyhrkhvgqtpaesdyqll
    eiarrlemygvrlhpakdregtrlslavahsgvlvfqghtkinafnwskvrklsfkrkrf
    liklrcqdtlefmmgsrdcckvfwkicveyhaffr