PDB entry 6d2k

View 6d2k on RCSB PDB site
Description: Crystal structure of the FERM domain of mouse FARP2
Class: signaling protein
Keywords: membrane targeting, SIGNALING PROTEIN
Deposited on 2018-04-13, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FERM, ARHGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6d2ka1, d6d2ka2, d6d2ka3, d6d2ka4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d2kA (A:)
    srmqekhmrirvklldstvelfdiepkcdgqvlltqvwkhlnliecdyfglefknvqsyw
    iwlepmkpiirqvrkpknavlrlavkffppdpgqlqeeytrylfalqlkrdlleerltct
    antaallishllqseigdydetldrehlkaneylpnqekslekildfhqrhtgqtpaesd
    fqvleiarklemygirfhmasdregtkinlavshmgvlvfqgttkintfnwskvrklsfk
    rkrfliklhpevhgpyqdtlefllgsrdecknfwkicveyhtffrlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d2kA (A:)
    srmqekhmrirvklldstvelfdiepkcdgqvlltqvwkhlnliecdyfglefknvqsyw
    iwlepmkpiirqvrkpknavlrlavkffppdpgqlqeeytrylfalqlkrdlleerltct
    antaallishllqseigdydetldrehlkaneylpnqekslekildfhqrhtgqtpaesd
    fqvleiarklemygirfhmasdregtkinlavshmgvlvfqgttkintfnwskvrklsfk
    rkrfliklhpevhgpyqdtlefllgsrdecknfwkicveyhtffrl