PDB entry 6d0v

View 6d0v on RCSB PDB site
Description: Tryptophan synthase Q114A mutant in complex with inhibitor N-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (F9F) at the alpha-site, aminoacrylate (P1T) at the beta site, and cesium ion at the metal coordination site
Class: lyase/lyase inhibitor
Keywords: F9F ligand, cesium ion, mutant beta-Q114A, Lyase, P1T ligand, LYASE-LYASE INHIBITOR complex
Deposited on 2018-04-11, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: TRPA, STM1727
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d0va_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: trpB, STM1726
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A2K1 (1-393)
      • engineered mutation (113)
      • expression tag (394)
    Domains in SCOPe 2.07: d6d0vb1, d6d0vb2
  • Heterogens: DMS, CL, F9F, EDO, P1T, CS, SER, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d0vA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d0vB (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkare
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d0vB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkare