PDB entry 6czf

View 6czf on RCSB PDB site
Description: The structure of E. coli PurF in complex with ppGpp-Mg
Class: transferase
Keywords: PurF, ppGpp, TRANSFERASE
Deposited on 2018-04-09, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amidophosphoribosyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: purF, b2312, JW2309
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Amidophosphoribosyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: purF, b2312, JW2309
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czfb1, d6czfb2
  • Chain 'C':
    Compound: Amidophosphoribosyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: purF, b2312, JW2309
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Amidophosphoribosyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: purF, b2312, JW2309
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czfd1, d6czfd2
  • Heterogens: G4P, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6czfB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czfB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnev
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6czfD (D:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czfD (D:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqne