PDB entry 6cyn

View 6cyn on RCSB PDB site
Description: CTX-M-14 N106S/D240G mutant
Class: hydrolase
Keywords: Beta-lactamase CTX-M-14, HYDROLASE
Deposited on 2018-04-06, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cyna_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cynb_
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cync_
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cynd_
  • Chain 'E':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cyne_
  • Chain 'F':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cynf_
  • Chain 'G':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cyng_
  • Chain 'H':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AM333_26030, APT94_14605, BET08_34355, BJJ90_27545, BK334_27290, BMR21_24310, BMR35_25520, BMR49_25760, BXT93_06855, CA268_29135, CDL37_21060, CR538_26855, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7
      • engineered mutation (80)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d6cynh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cynA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynA (A:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cynB (B:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynB (B:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cynC (C:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynC (C:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cynD (D:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynD (D:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cynE (E:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynE (E:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cynF (F:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynF (F:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6cynG (G:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynG (G:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaeg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6cynH (H:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cynH (H:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiae