PDB entry 6cyl

View 6cyl on RCSB PDB site
Description: Crystal Structure of Superoxide Dismutase double mutant (G74Q+Q149G) from Trichoderma reesei
Class: oxidoreductase
Keywords: enzymatic activity, OXIDOREDUCTASE
Deposited on 2018-04-06, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7
      • engineered mutation (72)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6cyla1, d6cyla2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-End)
      • engineered mutation (72)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6cylb1, d6cylb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-End)
      • engineered mutation (72)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6cylc1, d6cylc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7
      • engineered mutation (72)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6cyld1, d6cyld2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cylA (A:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cylA (A:)
    tfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsqial
    qaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgkall
    giqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayvdni
    wkvinwktaeqrfkgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cylB (B:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cylB (B:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cylC (C:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cylC (C:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cylD (D:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cylD (D:)
    vgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsqi
    alqaaikfnggqhinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgka
    llgiqgsgwgwlvkegsglrivttkdgdpvvggevpvfgidmwehayylqylngkaayvd
    niwkvinwktaeqrfkg