PDB entry 6cw3

View 6cw3 on RCSB PDB site
Description: Crystal structure of a yeast SAGA transcriptional coactivator Ada2/Gcn5 HAT subcomplex, crystal form 2
Class: gene regulation
Keywords: Ada2/Gcn5 structure, GENE REGULATION
Deposited on 2018-03-29, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CW3
  • Chain 'B':
    Compound: Antibody Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CW3
    Domains in SCOPe 2.07: d6cw3b1, d6cw3b2
  • Chain 'C':
    Compound: antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CW3
  • Chain 'D':
    Compound: Antibody Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CW3
    Domains in SCOPe 2.07: d6cw3d1, d6cw3d2
  • Chain 'E':
    Compound: Transcriptional adapter 2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: ADA2, YDR448W, D9461.33
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: histone acetyltransferase gcn5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: GCN5, ADA4, SWI9, YGR252W
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Transcriptional adapter 2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: ADA2, YDR448W, D9461.33
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: histone acetyltransferase gcn5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: GCN5, ADA4, SWI9, YGR252W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cw3B (B:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqgwanlitfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cw3B (B:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqgwanlitfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cw3D (D:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqgwanlitfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cw3D (D:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqgwanlitfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.