PDB entry 6cw0

View 6cw0 on RCSB PDB site
Description: Crystal structure of Cryptosporidium parvum bromodomain cgd2_2690
Class: transferase
Keywords: bromodomain, BI2536, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-03-29, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cgd2_2690 protein
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: cgd2_2690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cw0a_
  • Chain 'B':
    Compound: Cgd2_2690 protein
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: cgd2_2690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cw0b_
  • Heterogens: R78, GOL, UNX, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cw0A (A:)
    gmedysreysevllqlkelqdseaflepvnwkklglddypdivknpmdlktigkkikanf
    ytkaeqfwadidliwhncqlynhessevyqqsirmqdaannlrdml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cw0A (A:)
    edysreysevllqlkelqdseaflepvnwkklglddypdivknpmdlktigkkikanfyt
    kaeqfwadidliwhncqlynhessevyqqsirmqdaannlrdml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cw0B (B:)
    gmedysreysevllqlkelqdseaflepvnwkklglddypdivknpmdlktigkkikanf
    ytkaeqfwadidliwhncqlynhessevyqqsirmqdaannlrdml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cw0B (B:)
    dysreysevllqlkelqdseaflepvnwkklglddypdivknpmdlktigkkikanfytk
    aeqfwadidliwhncqlynhessevyqqsirmqdaannlrdml