PDB entry 6cvm

View 6cvm on RCSB PDB site
Description: Atomic resolution cryo-EM structure of beta-galactosidase
Class: hydrolase
Keywords: drift correction, radiation damage, drug discovery, precision medicine, computer-aided drug discovery, HYDROLASE
Deposited on 2018-03-28, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: EM
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (0-1020)
      • conflict (332)
      • conflict (869)
    Domains in SCOPe 2.07: d6cvma1, d6cvma2, d6cvma3, d6cvma4, d6cvma5
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (0-1020)
      • conflict (332)
      • conflict (869)
    Domains in SCOPe 2.07: d6cvmb1, d6cvmb2, d6cvmb3, d6cvmb4, d6cvmb5
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (0-1020)
      • conflict (332)
      • conflict (869)
    Domains in SCOPe 2.07: d6cvmc1, d6cvmc2, d6cvmc3, d6cvmc4, d6cvmc5
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (0-1020)
      • conflict (332)
      • conflict (869)
    Domains in SCOPe 2.07: d6cvmd1, d6cvmd2, d6cvmd3, d6cvmd4, d6cvmd5
  • Heterogens: PTQ, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvmA (A:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrvvriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    q
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvmB (B:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrvvriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    q
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvmC (C:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrvvriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    q
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvmD (D:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrvvriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    q