PDB entry 6cvl

View 6cvl on RCSB PDB site
Description: Crystal structure of the Escherichia coli ATPgS-bound MetNI methionine ABC transporter in complex with its MetQ binding protein
Class: membrane protein
Keywords: MetNIQ, Outward-facing conformation, Catalytic intermediate state, Membrane protein
Deposited on 2018-03-28, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MetI transmembrane subunit
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: metI, yaeE, b0198, JW0194
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cvla_
  • Chain 'B':
    Compound: MetI transmembrane subunit
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: metI, yaeE, b0198, JW0194
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cvlb_
  • Chain 'C':
    Compound: MetN nucleotide-binding subunit
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: metN, abc, b0199, JW0195
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30750 (1-343)
      • expression tag (0)
      • engineered mutation (166)
      • engineered mutation (295)
    Domains in SCOPe 2.07: d6cvlc1, d6cvlc2, d6cvlc3
  • Chain 'D':
    Compound: MetN nucleotide-binding subunit
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: metN, abc, b0199, JW0195
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30750 (1-343)
      • expression tag (0)
      • engineered mutation (166)
      • engineered mutation (295)
    Domains in SCOPe 2.07: d6cvld1, d6cvld2, d6cvld3
  • Chain 'E':
    Compound: MetQ periplasmic binding protein
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: metQ, yaeC, b0197, JW0193
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28635 (0-225)
      • engineered mutation (195)
  • Heterogens: HG, AGS, IOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvlA (A:)
    msepmmwllvrgvwetlamtfvsgffgfviglpvgvllyvtrpgqiianaklyrtvsaiv
    nifrsipfiillvwmipftrvivgtsiglqaaivpltvgaapfiarmvenalleiptgli
    easramgatpmqivrkvllpealpglvnaatitlitlvgysamggavgagglgqigyqyg
    yigynatvmntvlvllvilvyliqfagdrivravt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvlB (B:)
    msepmmwllvrgvwetlamtfvsgffgfviglpvgvllyvtrpgqiianaklyrtvsaiv
    nifrsipfiillvwmipftrvivgtsiglqaaivpltvgaapfiarmvenalleiptgli
    easramgatpmqivrkvllpealpglvnaatitlitlvgysamggavgagglgqigyqyg
    yigynatvmntvlvllvilvyliqfagdrivravt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvlC (C:)
    hmiklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpte
    gsvlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkr
    rvtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsi
    lellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqk
    fiqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnaiisa
    qmdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvlD (D:)
    hmiklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpte
    gsvlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkr
    rvtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsi
    lellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqk
    fiqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnaiisa
    qmdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv
    

  • Chain 'E':
    No sequence available.