PDB entry 6cv8

View 6cv8 on RCSB PDB site
Description: HADDOCK structure of the Rous sarcoma virus matrix protein (M-domain) in complex with inositol 1,4,5-trisphosphate
Class: viral protein
Keywords: RSV, ASV, Gag, IP3, VIRAL PROTEIN
Deposited on 2018-03-27, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix protein p19
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (0-86)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d6cv8a_
  • Heterogens: I3P

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cv8A (A:)
    seavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
    ramilgksgelktwglvlgalkaaree