PDB entry 6cut

View 6cut on RCSB PDB site
Description: Engineered Holo TrpB from Pyrococcus furiosus, PfTrpB7E6 with (2S,3S)-isopropylserine bound as the external aldimine
Class: lyase
Keywords: external aldimine, (2S, 3S)-isopropylserine, LYASE
Deposited on 2018-03-26, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-End)
      • engineered mutation (15-16)
      • engineered mutation (90)
      • engineered mutation (94)
      • engineered mutation (160)
      • engineered mutation (172)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (383)
    Domains in SCOPe 2.07: d6cuta_
  • Chain 'B':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-End)
      • engineered mutation (15-16)
      • engineered mutation (90)
      • engineered mutation (94)
      • engineered mutation (160)
      • engineered mutation (172)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (383)
    Domains in SCOPe 2.07: d6cutb_
  • Chain 'C':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-End)
      • engineered mutation (15-16)
      • engineered mutation (90)
      • engineered mutation (94)
      • engineered mutation (160)
      • engineered mutation (172)
      • engineered mutation (273)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d6cutc_
  • Chain 'D':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-End)
      • engineered mutation (15-16)
      • engineered mutation (90)
      • engineered mutation (94)
      • engineered mutation (160)
      • engineered mutation (172)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (383)
    Domains in SCOPe 2.07: d6cutd_
  • Heterogens: FEJ, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cutA (A:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkasgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cutA (A:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cutB (B:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkasgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cutB (B:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cutC (C:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkasgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cutC (C:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganviptakdainealrdweatfeythyligsv
    vgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfvndkkvk
    lvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgldypgvgp
    ehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsrdeii
    ivnlsgrgdkdldivlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cutD (D:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkasgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cutD (D:)
    mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkas