PDB entry 6csh

View 6csh on RCSB PDB site
Description: CryoEM structure of human enterovirus D68 emptied particle (pH 5.5 and 33 degrees Celsius)
Class: virus
Keywords: virus, genome release, acid
Deposited on 2018-03-20, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: EM
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral protein 1
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: viral protein 3
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cshb_
  • Chain 'C':
    Compound: viral protein 2
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cshB (B:)
    gvptyllpgsgqflttddhssapalpcfnptpemhipgqvrnmlevvqvesmmeinntes
    avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
    gsfmaagklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyrmfnn
    dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqldhlh
    aaeaayq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cshB (B:)
    gvptyllpgsgqflttddhssapalpcfnptpemhipgqvrnmlevvqvesmmeinntes
    avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
    gsfmaagklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyrmtna
    nvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdiglhaay
    

  • Chain 'C':
    No sequence available.