PDB entry 6cr1

View 6cr1 on RCSB PDB site
Description: adalimumab EFab
Class: immune system
Keywords: EFab, IgE, IMMUNE SYSTEM
Deposited on 2018-03-16, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of adalimumab EFab (VH-IgE CH2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CR1 (0-End)
    Domains in SCOPe 2.07: d6cr1h1, d6cr1h2, d6cr1h3
  • Chain 'L':
    Compound: Light chain of adalimumab EFab (VL-IgE CH2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CR1 (0-210)
    Domains in SCOPe 2.07: d6cr1l1, d6cr1l2
  • Heterogens: PEG, NO3, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6cr1H (H:)
    evqlvesggglvqpgrslrlscaasgftfddyamhwvrqapgkglewvsaitwnsghidy
    adsvegrftisrdnaknslylqmnslraedtavyycakvsylstassldywgqgtlvtvs
    sastkgptvkilqsicdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstast
    tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cr1H (H:)
    evqlvesggglvqpgrslrlscaasgftfddyamhwvrqapgkglewvsaitwnsghidy
    adsvegrftisrdnaknslylqmnslraedtavyycakvsylstassldywgqgtlvtvs
    sastkgptvkilqsicdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstast
    tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkca
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cr1L (L:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaaptvkilqs
    scdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttqegelastqselt
    lsqkhwlsdrtytcqvtyqghtfedsgkkca