PDB entry 6cqz

View 6cqz on RCSB PDB site
Description: Crystal Structure of Recombinant Human Acetylcholinesterase Inhibited by VX
Class: hydrolase
Keywords: Hydrolase
Deposited on 2018-03-16, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqza_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqzb_
  • Heterogens: FUC, NAG, VX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cqzA (A:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqzA (A:)
    redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
    ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
    fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
    vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
    earrratqlahlvgcppggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdg
    dflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrv
    gvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarv
    yayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfar
    tgdpnepqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cqzB (B:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqzB (B:)
    edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
    tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
    ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
    qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
    arrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdfls
    dtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpq
    vsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayv
    fehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdp
    nepqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa