PDB entry 6cq7

View 6cq7 on RCSB PDB site
Description: The SH3 domain of MLK3 in complex with poly-proline peptide derived from Htt
Class: transferase
Keywords: Huntington, peptide fusion, mixed lineage kinase 3, TRANSFERASE
Deposited on 2018-03-14, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 11, Huntingtin fusion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HTT, HD, IT15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16584 (Start-71)
    • PDB 6CQ7 (72-End)
    Domains in SCOPe 2.07: d6cq7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cq7A (A:)
    gshmyanpvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifp
    snyvsrgggppppgpavaee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cq7A (A:)
    npvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvsr
    gggppppgpavae