PDB entry 6cpz

View 6cpz on RCSB PDB site
Description: Selenomethionine mutant (I6Sem) of protein GB1 examined by X-ray diffraction
Class: immune system
Keywords: Immunoglobulin G-binding protein domain B1, IMMUNE SYSTEM
Deposited on 2018-03-14, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (5)
    Domains in SCOPe 2.07: d6cpza1, d6cpza2
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (5)
    Domains in SCOPe 2.07: d6cpzb1, d6cpzb2
  • Heterogens: MRD, MPD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cpzA (A:)
    gqyklmlngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cpzB (B:)
    gqyklmlngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte