PDB entry 6cp0

View 6cp0 on RCSB PDB site
Description: SdcA in complex with the E2, UbcH5C
Class: ligase
Keywords: Complex, Bacterial E3 Ligase, E2, LIGASE
Deposited on 2018-03-13, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SdcA
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RCR3
      • engineered mutation (44)
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D3, UBC5C, UBCH5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (2-148)
      • expression tag (0-1)
      • engineered mutation (86)
    Domains in SCOPe 2.08: d6cp0b1, d6cp0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6cp0B (B:)
lamalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfpt
dypfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddp
lvpeiariyktdrdkynrisrewtqkyam