PDB entry 6con

View 6con on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis IpdAB
Class: hydrolase
Keywords: Cholesterol, Ring cleaving, virulence factor, HYDROLASE
Deposited on 2018-03-12, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CoA-transferase subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gctA, CRX58_09925, ERS007663_04080, ERS007665_02371, ERS023446_02783, ERS027646_00148, ERS027654_03521, ERS027656_00696, ERS124361_01188, SAMEA2682864_02618, SAMEA2683035_00650
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CoA-transferase subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: catJ, CRX58_09930, ERS007657_01926, ERS007661_02237, ERS007665_02370, ERS007670_03185, ERS007672_03945, ERS007679_04090, ERS007681_03977, ERS007688_03438, ERS007703_04697, ERS007722_01813, ERS007741_03174, ERS023446_02782, ERS024213_01521, ERS024276_02483, ERS027644_04603, ERS027646_00147, ERS027656_00695, ERS027659_03102, ERS027661_03605, ERS027666_03707, ERS124361_01187, SAMEA2682864_02619, SAMEA2683035_00651
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6conb_
  • Chain 'C':
    Compound: CoA-transferase subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gctA, CRX58_09925, ERS007663_04080, ERS007665_02371, ERS023446_02783, ERS027646_00148, ERS027654_03521, ERS027656_00696, ERS124361_01188, SAMEA2682864_02618, SAMEA2683035_00650
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: CoA-transferase subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: catJ, CRX58_09930, ERS007657_01926, ERS007661_02237, ERS007665_02370, ERS007670_03185, ERS007672_03945, ERS007679_04090, ERS007681_03977, ERS007688_03438, ERS007703_04697, ERS007722_01813, ERS007741_03174, ERS023446_02782, ERS024213_01521, ERS024276_02483, ERS027644_04603, ERS027646_00147, ERS027656_00695, ERS027659_03102, ERS027661_03605, ERS027666_03707, ERS124361_01187, SAMEA2682864_02619, SAMEA2683035_00651
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cond_
  • Chain 'E':
    Compound: CoA-transferase subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gctA, CRX58_09925, ERS007663_04080, ERS007665_02371, ERS023446_02783, ERS027646_00148, ERS027654_03521, ERS027656_00696, ERS124361_01188, SAMEA2682864_02618, SAMEA2683035_00650
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: CoA-transferase subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: catJ, CRX58_09930, ERS007657_01926, ERS007661_02237, ERS007665_02370, ERS007670_03185, ERS007672_03945, ERS007679_04090, ERS007681_03977, ERS007688_03438, ERS007703_04697, ERS007722_01813, ERS007741_03174, ERS023446_02782, ERS024213_01521, ERS024276_02483, ERS027644_04603, ERS027646_00147, ERS027656_00695, ERS027659_03102, ERS027661_03605, ERS027666_03707, ERS124361_01187, SAMEA2682864_02619, SAMEA2683035_00651
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6conf_
  • Chain 'G':
    Compound: CoA-transferase subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gctA, CRX58_09925, ERS007663_04080, ERS007665_02371, ERS023446_02783, ERS027646_00148, ERS027654_03521, ERS027656_00696, ERS124361_01188, SAMEA2682864_02618, SAMEA2683035_00650
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: CoA-transferase subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: catJ, CRX58_09930, ERS007657_01926, ERS007661_02237, ERS007665_02370, ERS007670_03185, ERS007672_03945, ERS007679_04090, ERS007681_03977, ERS007688_03438, ERS007703_04697, ERS007722_01813, ERS007741_03174, ERS023446_02782, ERS024213_01521, ERS024276_02483, ERS027644_04603, ERS027646_00147, ERS027656_00695, ERS027659_03102, ERS027661_03605, ERS027666_03707, ERS124361_01187, SAMEA2682864_02619, SAMEA2683035_00651
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6conh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6conB (B:)
    mstraevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtp
    algktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmf
    gvrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnl
    gvfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidp
    kslrdreirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6conB (B:)
    straevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtpa
    lgktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmfg
    vrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnlg
    vfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidpk
    slrdreirs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6conD (D:)
    mstraevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtp
    algktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmf
    gvrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnl
    gvfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidp
    kslrdreirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6conD (D:)
    straevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtpa
    lgktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmfg
    vrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnlg
    vfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidpk
    slrdreirs
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6conF (F:)
    mstraevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtp
    algktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmf
    gvrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnl
    gvfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidp
    kslrdreirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6conF (F:)
    straevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtpa
    lgktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmfg
    vrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnlg
    vfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidpk
    slrdreirs
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6conH (H:)
    mstraevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtp
    algktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmf
    gvrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnl
    gvfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidp
    kslrdreirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6conH (H:)
    straevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtpa
    lgktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmfg
    vrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnlg
    vfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidpk
    slrdreirs