PDB entry 6cn6

View 6cn6 on RCSB PDB site
Description: RORC2 LBD complexed with compound 34
Class: signaling protein
Keywords: Nuclear receptor, SIGNALING PROTEIN
Deposited on 2018-03-07, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (19)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d6cn6a_
  • Heterogens: F7J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cn6A (A:)
    tpeapyaslteiehlvqsvsksyretcqlrledllrqrsnifsreevtgyqrksmwemwe
    rcahhlteaiqyvvefakrlsgfmelsqndqivllkagamevvlvrmcraynadnrtvff
    egkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrk
    veqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaaf
    pplykelfstetespvgls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cn6A (A:)
    aslteiehlvqsvsksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelsqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivv