PDB entry 6cn5

View 6cn5 on RCSB PDB site
Description: HUMAN RETENOID-RELATED ORPHAN RECEPTOR-GAMMA LIGAND- BINDING DOMAIN IN COMPLEX WITH INDOLE LIGAND CP9b IN INVERSE AGONIST CONFORMATION
Class: signaling protein
Keywords: ror gamma, ligand-binding, nuclear receptor, non steroidal, indole, pfizer, inverse agonist, signaling protein
Deposited on 2018-03-07, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cn5a_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cn5b_
  • Heterogens: F7M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cn5A (A:)
    gptpeapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwem
    wercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtv
    ffegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqek
    rkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqa
    afpplykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cn5A (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cn5B (B:)
    gptpeapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwem
    wercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtv
    ffegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqek
    rkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqa
    afpplykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cn5B (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvq