PDB entry 6cmp

View 6cmp on RCSB PDB site
Description: Closed structure of inactive SHP2 mutant C459E
Class: hydrolase
Keywords: protein tyrosine phosphatase, src homology domain 2, inactive state, inactive mutant, HYDROLASE
Deposited on 2018-03-06, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (461)
    Domains in SCOPe 2.07: d6cmpa1, d6cmpa2, d6cmpa3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (461)
    Domains in SCOPe 2.07: d6cmpb1, d6cmpb2, d6cmpb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cmpA (A:)
    gsgmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiq
    ntgdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghl
    sgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqel
    kydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskla
    ettdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdp
    nepvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmtt
    kevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwq
    yhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhesagigrtgtfividilid
    iirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrri
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmpA (A:)
    rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgkeae
    klltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkydvgg
    gerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklakqgfwe
    efetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgvsdyinaniimpef
    etksyiatqgclqntvndfwrmvfqensrvivmttkkcvkywpdeyalkeygvmrvrnvk
    esaahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesi
    mdagpvvvhesagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqtea
    qyrfiymavqhyietlqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cmpB (B:)
    gsgmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiq
    ntgdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghl
    sgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqel
    kydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskla
    ettdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdp
    nepvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmtt
    kevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwq
    yhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhesagigrtgtfividilid
    iirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrri
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmpB (B:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkeknvielkyplncadptserwfhghlsgkeaek
    lltekgkhgsflvresqshpgdfvlsvrtgkskvthvmircqelkydvgggerfdsltdl
    vehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeckll
    ysrkegqrqenknknryknilpfdhtrvvlhdgdpnepvsdyinaniimpefkksyiatq
    gclqntvndfwrmvfqensrvivmttkkcvkywpdeyalkeygvmrvrnvkesaahdytl
    relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
    esagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
    qhyietlqr