PDB entry 6ckx

View 6ckx on RCSB PDB site
Description: Structure of CDK12/CycK in complex with a small molecule inhibitor N-(4-(1-methyl-1H-pyrazol-4-yl)phenyl)-N-((1r,4r)-4-(quinazolin-2-ylamino)cyclohexyl)acetamide
Class: transferase/inhibitor
Keywords: Kinase, Transferase, Inhibitor, Transferase-Cell Cycle-Inhibitor complex, TRANSFERASE-INHIBITOR complex
Deposited on 2018-03-01, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK12, CRK7, CRKRS, KIAA0904
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ckxb1, d6ckxb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK12, CRK7, CRKRS, KIAA0904
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ckxd1, d6ckxd2
  • Heterogens: MG, 8M1, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ckxB (B:)
    gmkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifd
    vgtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikt
    arsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiq
    klvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfv
    qdvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ckxB (B:)
    pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf
    ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm
    vlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqw
    epeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ckxD (D:)
    gmkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifd
    vgtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikt
    arsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiq
    klvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfv
    qdvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ckxD (D:)
    pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf
    ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm
    vlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqw
    epeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys