PDB entry 6ckq

View 6ckq on RCSB PDB site
Description: Solution structure of the Burkholderia thailandensis transcription antitermination protein NusB (BTH_I1529) - Seattle Structural Genomics Center for Infectious Disease target ButhA.17903.a
Class: transcription
Keywords: infectious disease model, transcription antitermnation, NusA, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSCRIPTION
Deposited on 2018-02-28, released 2018-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription antitermination protein NusB
  Species: Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) [TaxId:271848]
  Gene: nusB, BTH_I1529
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2SYC5 (4-148)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d6ckqa1, d6ckqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ckqA (A:)
  gpgsmkksarrqsrelatqglyqwllsnaapgeidaqlrgalgydkadktlldtilhgvi
  rehatlaeaispsldrpidqlspveravlliatyelthqietpyrviineavelaktfgg
  sdgykyvngvldklavklrpaetqarrga