PDB entry 6cjr

View 6cjr on RCSB PDB site
Description: Candida albicans Hsp90 nucleotide binding domain in complex with SNX-2112
Class: chaperone
Keywords: Hsp90. ATPase, CHAPERONE
Deposited on 2018-02-26, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein 90 homolog
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: HSP90, CAALFM_C702030WA, CaJ7.0234, CaO19.13868, CaO19.6515
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46598 (18-229)
      • expression tag (17)
    Domains in SCOPe 2.07: d6cjra1, d6cjra2
  • Chain 'B':
    Compound: Heat shock protein 90 homolog
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: HSP90, CAALFM_C702030WA, CaJ7.0234, CaO19.13868, CaO19.6515
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cjrb_
  • Heterogens: E0G, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cjrA (A:)
    mhhhhhhssgrenlyfqgetheftaeisqlmsliintvysnkeiflrelisnasdaldki
    ryqalsdpsqlesepelfiriipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfm
    ealsagadvsmigqfgvgfyslflvadhvqviskhnddeqyvwesnaggkftvtldetne
    rlgrgtmlrlflkedqleyleekrikevvkkhsefvaypiqlvvtkevek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjrA (A:)
    getheftaeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepel
    firiipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgv
    gfyslflvadhvqviskhnddeqyvwesnaggkftvtldetnerlgrgtmlrlflkedql
    eyleekrikevvkkhsefvaypiqlvvtkevek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cjrB (B:)
    mhhhhhhssgrenlyfqgetheftaeisqlmsliintvysnkeiflrelisnasdaldki
    ryqalsdpsqlesepelfiriipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfm
    ealsagadvsmigqfgvgfyslflvadhvqviskhnddeqyvwesnaggkftvtldetne
    rlgrgtmlrlflkedqleyleekrikevvkkhsefvaypiqlvvtkevek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjrB (B:)
    etheftaeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelf
    iriipqkdqkvleirdsgigmtkadlvnnlaksgtksfmealsagadvsmigqfgvgfys
    lflvadhvqviskhnddeqyvwesngkftvtldetnerlgrgtmlrlflkedqleyleek
    rikevvkkhsefvaypiqlvvtkevek