PDB entry 6ciu

View 6ciu on RCSB PDB site
Description: Structure of a Thr-rich interface in an Azami Green tetramer
Class: fluorescent protein
Keywords: beta barrel, threonine-rich interface, threonine, FLUORESCENT PROTEIN
Deposited on 2018-02-25, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azami-Green
    Species: Galaxea fascicularis [TaxId:46745]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60I25 (14-End)
      • chromophore (76)
      • engineered mutation (131)
      • engineered mutation (133)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d6ciua_
  • Chain 'B':
    Compound: Azami-Green
    Species: Galaxea fascicularis [TaxId:46745]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60I25 (14-End)
      • chromophore (76)
      • engineered mutation (131)
      • engineered mutation (133)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d6ciub_
  • Chain 'C':
    Compound: Azami-Green
    Species: Galaxea fascicularis [TaxId:46745]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60I25 (Start-237)
      • chromophore (76)
      • engineered mutation (131)
      • engineered mutation (133)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d6ciuc_
  • Chain 'D':
    Compound: Azami-Green
    Species: Galaxea fascicularis [TaxId:46745]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60I25
      • chromophore (76)
      • engineered mutation (131)
      • engineered mutation (133)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d6ciud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ciuA (A:)
    mgsshhhhhhsqmvsvikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvteg
    aplpfaydilttvfqygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsni
    smrgdcffyditftgtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggg
    hyrcdfkttykakkdvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ciuA (A:)
    svikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvf
    qygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditft
    gtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakk
    dvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ciuB (B:)
    mgsshhhhhhsqmvsvikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvteg
    aplpfaydilttvfqygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsni
    smrgdcffyditftgtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggg
    hyrcdfkttykakkdvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ciuB (B:)
    svikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvf
    qygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditft
    gtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakk
    dvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ciuC (C:)
    mgsshhhhhhsqmvsvikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvteg
    aplpfaydilttvfqygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsni
    smrgdcffyditftgtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggg
    hyrcdfkttykakkdvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ciuC (C:)
    vikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfq
    ygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditftg
    tnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakkd
    vrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ciuD (D:)
    mgsshhhhhhsqmvsvikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvteg
    aplpfaydilttvfqygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsni
    smrgdcffyditftgtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggg
    hyrcdfkttykakkdvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ciuD (D:)
    vikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfq
    ygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditftg
    tnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakkd
    vrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsq