PDB entry 6ci6

View 6ci6 on RCSB PDB site
Description: Crystal structure of equine serum albumin in complex with nabumetone
Class: transport protein
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, serum albumin, equine, nabumetone, TRANSPORT PROTEIN
Deposited on 2018-02-23, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ci6a1, d6ci6a2, d6ci6a3
  • Heterogens: SO4, NBO, TRS, KNA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ci6A (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgredkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ci6A (A:)
    hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaenc
    dkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaq
    caafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipkld
    alkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhk
    ecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlp
    alaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccae
    adppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptl
    veigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslae
    rrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeq
    lktvlgnfsafvakccgredkeacfaeegpklvassqlala