PDB entry 6cgt

View 6cgt on RCSB PDB site
Description: hoxa complex of cyclodextrin glycosyltransferase mutant
Deposited on 1998-06-06, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.167
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cgt_ (-)
    dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
    indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
    littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
    sdfsslengiykntydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqk
    swmssiyahkpvftfgewflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
    yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
    gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiaygstqqrwinndvyv
    yerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlngnnitstngsinnft
    laagatavwqyttaettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaai
    tswedtqikvtipsvaagnyavkvaasgvnsnaynnftiltgdqvtvrfvvnnasttlgq
    nlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsvpagkqlefkffkkngstit
    wesgsnhtfttpasgtatvtvnwq