PDB entry 6cgq

View 6cgq on RCSB PDB site
Description: Threonine synthase from Bacillus subtilis ATCC 6633 with PLP and PLP-Ala
Class: lyase
Keywords: ThrC, threonine synthase, BIOSYNTHETIC PROTEIN, LYASE
Deposited on 2018-02-20, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Bacillus subtilis subsp. spizizenii [TaxId:96241]
    Gene: thrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgqa_
  • Chain 'B':
    Compound: threonine synthase
    Species: Bacillus subtilis subsp. spizizenii [TaxId:96241]
    Gene: thrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgqb_
  • Heterogens: PLP, PO4, F0G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cgqA (A:)
    maswkglihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsf
    kdrgmvmavakakeegndtimcastgntsaaaaayaaranmkciviipngkiafgklaqa
    vmygaeiiaidgnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapd
    vlaipvgnagnisaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatai
    rignpaswdkavkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqv
    ksgeipkgskvvavltgnglkdpntavdiseikpvtlptnedsileyvkgaarv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgqA (A:)
    glihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsfkdrgm
    vmavakakeegndtimcastgntsaaaaayaaranmkciviipnklaqavmygaeiiaid
    gnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapdvlaipvgnagn
    isaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatairignpaswdka
    vkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqvksgeipkgskv
    vavltgnglkdpntavdiseikpvtlptnedsileyvkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cgqB (B:)
    maswkglihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsf
    kdrgmvmavakakeegndtimcastgntsaaaaayaaranmkciviipngkiafgklaqa
    vmygaeiiaidgnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapd
    vlaipvgnagnisaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatai
    rignpaswdkavkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqv
    ksgeipkgskvvavltgnglkdpntavdiseikpvtlptnedsileyvkgaarv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgqB (B:)
    wkglihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsfkdr
    gmvmavakakeegndtimcastgntsaaaaayaaranmkciviipngkiafgklaqavmy
    gaeiiaidgnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapdvla
    ipvgnagnisaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatairig
    npaswdkavkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqvksg
    eipkgskvvavltgnglkdpntavdiseikpvtlptnedsileyv