PDB entry 6cfn

View 6cfn on RCSB PDB site
Description: Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain
Class: DNA binding protein
Keywords: DNA binding domain, nuclear receptor, glucocorticoid receptor, DNA BINDING PROTEIN
Deposited on 2018-02-15, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfna_
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfnb_
  • Chain 'C':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfnc_
  • Chain 'D':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfnd_
  • Chain 'E':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfne_
  • Chain 'F':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfnf_
  • Chain 'G':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfng_
  • Chain 'H':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfnh_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cfnA (A:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnA (A:)
    klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
    rkclqagmnlearktkkkik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cfnB (B:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnB (B:)
    klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
    rkclqagmnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cfnC (C:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnC (C:)
    lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
    kclqagmnlearktkkkikgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cfnD (D:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnD (D:)
    lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
    kclqagmn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cfnE (E:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnE (E:)
    klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
    rkclqagmnlearktkkki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cfnF (F:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnF (F:)
    pklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
    yrkclqagmnlearktkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6cfnG (G:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnG (G:)
    pklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
    yrkclqagmn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6cfnH (H:)
    spklclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqattg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfnH (H:)
    klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
    rkclqagmn