PDB entry 6cep

View 6cep on RCSB PDB site
Description: Sus scrofa heart L-lactate dehydrogenase ternary complex with NADH and oxamate
Class: oxidoreductase
Keywords: ternary complex, heart isoform (H-chain), OXIDOREDUCTASE
Deposited on 2018-02-12, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase B chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cepa1, d6cepa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase B chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cepb1, d6cepb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase B chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cepc1, d6cepc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase B chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cepd1, d6cepd2
  • Heterogens: NAD, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cepA (A:)
    matlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklk
    gemmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkf
    iipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklg
    vhpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesay
    eviklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnarg
    ltsvinqklkddevaqlknsadtlwgiqkdlkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cepA (A:)
    atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgv
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnargl
    tsvinqklkddevaqlknsadtlwgiqkdlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cepB (B:)
    matlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklk
    gemmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkf
    iipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklg
    vhpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesay
    eviklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnarg
    ltsvinqklkddevaqlknsadtlwgiqkdlkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cepB (B:)
    atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrvqrnvnvfkfiipqivkyspd
    ciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgvhpsschgwil
    gehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesayeviklkgytnw
    aiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnargltsvinqklkd
    devaqlknsadtlwgiqkdlkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cepC (C:)
    matlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklk
    gemmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkf
    iipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklg
    vhpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesay
    eviklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnarg
    ltsvinqklkddevaqlknsadtlwgiqkdlkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cepC (C:)
    atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgv
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnargl
    tsvinqklkddevaqlknsadtlwgiqkdlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cepD (D:)
    matlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklk
    gemmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkf
    iipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklg
    vhpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesay
    eviklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnarg
    ltsvinqklkddevaqlknsadtlwgiqkdlkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cepD (D:)
    atlkekliapvatipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkgemmd
    lqhgslflqtpkivadkdysvtanskivvvtagvvqrnvnvfkfiipqivkyspdciiiv
    vsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgvhpsschgwilgehgd
    ssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesayeviklkgytnwaigls
    vadliesmlknlsrihpvstmvqgmygienevflslpcvlnargltsvinqklkddevaq
    lknsadtlwgiqkdlkd