PDB entry 6cds

View 6cds on RCSB PDB site
Description: Human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with PIP2
Class: signaling protein
Keywords: NEUROFIBROMIN 2, SCHWANNOMIN, merlin, Tumor Suppressor protein, SIGNALING PROTEIN
Deposited on 2018-02-09, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35240 (Start-338)
      • engineered mutation (301)
    Domains in SCOPe 2.07: d6cdsa1, d6cdsa2, d6cdsa3
  • Chain 'B':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35240 (Start-338)
      • engineered mutation (301)
    Domains in SCOPe 2.07: d6cdsb1, d6cdsb2, d6cdsb3
  • Heterogens: PIO, PO4, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cdsA (A:)
    magaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretw
    ffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlffl
    qvkkqildekiycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmt
    pemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalg
    lhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlc
    ienhdlfmrrrkadslevqqmkaqareekarkqmerqrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cdsA (A:)
    krkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvaw
    lkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycp
    peasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyae
    hrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpki
    sfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcienhdlfmrrrkad
    slevqqmkaqareekarkqmerqrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cdsB (B:)
    magaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretw
    ffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlffl
    qvkkqildekiycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmt
    pemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalg
    lhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlc
    ienhdlfmrrrkadslevqqmkaqareekarkqmerqrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cdsB (B:)
    krkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvaw
    lkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycp
    peasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyae
    hrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpki
    sfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcienhdlfmrrrkad
    slevqqmkaqareekarkqmerqrl