PDB entry 6ca7

View 6ca7 on RCSB PDB site
Description: Crystal structure of PCT64_13C, a strain specific anti-HIV antibody
Class: immune system
Keywords: Antibody, neutralizing, IMMUNE SYSTEM
Deposited on 2018-01-29, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PCT64_13C heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA7 (0-End)
  • Chain 'L':
    Compound: PCT64_13C light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA7 (0-End)
    Domains in SCOPe 2.07: d6ca7l1, d6ca7l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ca7L (L:)
    eivltqspgtlslspgeratlscrasqsvsnnylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca7L (L:)
    eivltqspgtlslspgeratlscrasqsvsnnylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge