PDB entry 6c9f

View 6c9f on RCSB PDB site
Description: AMP-activated protein kinase bound to pharmacological activator R734
Class: transferase
Keywords: AMPK, activator, TRANSFERASE
Deposited on 2018-01-26, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkaa1, Ampk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13131 (10-468)
      • expression tag (8-9)
    • Uniprot Q13131 (469-End)
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y478 (Start-203)
      • conflict (41)
  • Chain 'C':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9fc1, d6c9fc2
  • Heterogens: R34, STU, AMP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c9fC (C:)
    metvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtslqvkka
    ffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkietwrev
    ylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkflklfi
    tefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdi
    yskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrl
    vvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9fC (C:)
    nsvytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgm
    ltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssl
    irnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyania
    mvrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtka
    lqhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvlt