PDB entry 6c95

View 6c95 on RCSB PDB site
Description: The Human NatA (Naa10/Naa15) amino-terminal acetyltransferase complex bound to HYPK
Class: transferase
Keywords: NatA, HYPK, N-terminal acetylation, Huntingtin interacting protein, protein complex, TRANSFERASE
Deposited on 2018-01-25, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: N-alpha-acetyltransferase 15, NatA auxiliary subunit
  Species: Homo sapiens [TaxId:9606]
  Gene: NAA15, GA19, NARG1, NATH, TBDN100
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BXJ9 (0-865)
• Chain 'B':
  Compound: N-alpha-acetyltransferase 10
  Species: Homo sapiens [TaxId:9606]
  Gene: NAA10, ARD1, ARD1A, TE2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41227 (0-234)
  Domains in SCOPe 2.08: d6c95b_
• Chain 'D':
  Compound: Huntingtin-interacting protein K
  Species: Homo sapiens [TaxId:9606]
  Gene: HYPK, C15orf63, HSPC136
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NX55 (0-128)
• Heterogens: IHP, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6c95B (B:)
  mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
  eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
  lysntlnfqisevepkyyadgedayamkrdltqmadelrrhlelkekgrhvvlgaienkv
  eskgnsppssgeacreekglaaedsggdskdlsevsettestdvkdsseasdsas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6c95B (B:)
  mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
  eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
  lysntlnfqisevepkyyadgedayamkrdltqmadelrr
  

  
  
• Chain 'D':
  No sequence available.