PDB entry 6c7a

View 6c7a on RCSB PDB site
Description: Conformational Changes in a Class A Beta lactamase that Prime it for Catalysis
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-01-22, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase toho-1
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (1-260)
      • expression tag (0)
      • conflict (42)
      • conflict (244)
      • conflict (246)
    Domains in SCOPe 2.07: d6c7aa1, d6c7aa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c7aA (A:)
    asvqqqlealekssggrlgvalintadnsqilyraderfamcatskvmaaaavlkqsesd
    khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
    vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
    vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
    qkaenrndilaaaakivthgf