PDB entry 6c6q

View 6c6q on RCSB PDB site
Description: Crystal Structure of the Murine Norovirus VP1 P Domain in complex with the CD300lf Receptor
Class: viral protein/lipid binding protein
Keywords: Norovirus, Capsid protein, Protruding domain, Ig-V like, VIRAL PROTEIN-LIPID BINDING PROTEIN complex, CD300lf, VP1, myeloid receptor, CMRF-35-like molecule-1, CLM-1, CLM1, DIR2, IREM1, LMIR3, PIGR3, IgSF13
Deposited on 2018-01-19, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c6qd_
  • Chain 'F':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6SJQ7 (1-112)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6c6qf_
  • Heterogens: EDO, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c6qD (D:)
    medpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkk
    nrvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6qD (D:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c6qF (F:)
    medpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkk
    nrvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt