PDB entry 6c6i

View 6c6i on RCSB PDB site
Description: Crystal structure of a chimeric NDM-1 metallo-beta-lactamase harboring the IMP-1 L3 loop
Class: hydrolase
Keywords: Chimeric protein, NDM-1, Zn-contaning protein, HYDROLASE
Deposited on 2018-01-18, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2 chimera
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (Start-26)
      • linker (27-37)
    • Uniprot C7C422 (38-End)
    Domains in SCOPe 2.07: d6c6ia_
  • Chain 'B':
    Compound: Metallo-beta-lactamase type 2 chimera
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (Start-26)
      • linker (27-37)
    • Uniprot C7C422 (38-End)
    Domains in SCOPe 2.07: d6c6ib_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c6iA (A:)
    ghmetgdqrfgdlvfrqlapnvwqhtsfeevngwgvvpsnglivrdggrvlvvdtawtdd
    qtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmva
    aqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskak
    slgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6iA (A:)
    gdqrfgdlvfrqlapnvwqhtsfeevngwgvvpsnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c6iB (B:)
    ghmetgdqrfgdlvfrqlapnvwqhtsfeevngwgvvpsnglivrdggrvlvvdtawtdd
    qtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmva
    aqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskak
    slgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6iB (B:)
    gdqrfgdlvfrqlapnvwqhtsfeevngwgvvpsnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl