PDB entry 6c5w

View 6c5w on RCSB PDB site
Description: Crystal structure of the mitochondrial calcium uniporter
Class: membrane protein
Keywords: membrane protein
Deposited on 2018-01-17, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium uniporter
    Species: Metarhizium acridum (strain CQMa 102) [TaxId:655827]
    Gene: MAC_01752
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calcium uniporter
    Species: Metarhizium acridum (strain CQMa 102) [TaxId:655827]
    Gene: MAC_01752
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nanobody
    Species: unknown [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C5W (0-116)
    Domains in SCOPe 2.08: d6c5wc_
  • Chain 'E':
    Compound: Nanobody
    Species: unknown [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C5W (0-116)
    Domains in SCOPe 2.08: d6c5we_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6c5wC (C:)
vqlqesggglvqaggslrlscaasgtifsphymgwyrqapgkerefvagigfgtttnyan
svkgrftisrdnakntvylqmnslkpedtavyycaarlypilghtywgqgtqvtvss

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6c5wE (E:)
vqlqesggglvqaggslrlscaasgtifsphymgwyrqapgkerefvagigfgtttnyan
svkgrftisrdnakntvylqmnslkpedtavyycaarlypilghtywgqgtqvtvss