PDB entry 6c5j

View 6c5j on RCSB PDB site
Description: S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 1)
Class: immune system, sugar binding protein
Keywords: Carbohydrate, Lipopolysaccharide, Antibody, Antigen, Complex, Chlamydia, SUGAR BINDING PROTEIN, IMMUNE SYSTEM
Deposited on 2018-01-16, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IgG1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C5J (0-102)
    • Uniprot Q99LC4 (102-217)
  • Chain 'L':
    Compound: IgG1 Fab Light Chain (Kappa)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c5jl1, d6c5jl2
  • Heterogens: NAG, GP1, Z9M, KDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6c5jL (L:)
    dvlmtqtplslpvslgdqasiscrssqtivhkngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaadlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c5jL (L:)
    dvlmtqtplslpvslgdqasiscrssqtivhkngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaadlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn