PDB entry 6c5i

View 6c5i on RCSB PDB site
Description: Unliganded S25-5 Fab
Class: sugar binding protein
Keywords: Complex, Lipopolysaccharide, Antibody, Antigen, Chlamydia, SUGAR BINDING PROTEIN
Deposited on 2018-01-16, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab IgG1 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C5I (0-102)
    • Uniprot Q99LC4 (102-217)
  • Chain 'L':
    Compound: Fab IgG1 (kappa) Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c5il1, d6c5il2
  • Heterogens: NAG, CL, NI, PG0, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c5iL (L:)
    dvlmtqsplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvsnrf
    ygvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec