PDB entry 6c56

View 6c56 on RCSB PDB site
Description: Crystal structure of mutant human geranylgeranyl pyrophosphate synthase (Y246D) in its Apo form
Class: transferase
Keywords: isoprenoid pathway, isopentenyl transferase, transferase
Deposited on 2018-01-15, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749 (22-End)
      • expression tag (18-21)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d6c56a1, d6c56a2
  • Chain 'B':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749 (22-End)
      • expression tag (21)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d6c56b1, d6c56b2
  • Heterogens: VT0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c56A (A:)
    mhhhhhhssgvdlgtenlyfqsmektqetvqrillepykyllqlpgkqvrtklsqafnhw
    lkvpedklqiiievtemlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyfl
    glekvltldhpdavklftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfgl
    avglmqlfsdykedlkpllntlglffqirddyanlhskeysenksfcedltegkfsfpti
    haiwsrpestqvqnilrqrtenidikkdcvhyledvgsfeytrntlkeleakaykqidar
    ggnpelvalvkhlskmfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c56A (A:)
    yfqsmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievteml
    hnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklft
    rqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpl
    lntlglffqirddyanlhsnksfcedltegkfsfptihaiwsrilrqrtenidikkdcvh
    yledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c56B (B:)
    mhhhhhhssgvdlgtenlyfqsmektqetvqrillepykyllqlpgkqvrtklsqafnhw
    lkvpedklqiiievtemlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyfl
    glekvltldhpdavklftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfgl
    avglmqlfsdykedlkpllntlglffqirddyanlhskeysenksfcedltegkfsfpti
    haiwsrpestqvqnilrqrtenidikkdcvhyledvgsfeytrntlkeleakaykqidar
    ggnpelvalvkhlskmfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c56B (B:)
    smektqetvqrillepykyllqlpgrtklsqafnhwlkvpedklqiiievtemlhnasll
    iddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllel
    hqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlgl
    ffqirddyanlhskesfcedltegkfsfptihaiwskdcvhyledvgsfeytrntlkele
    akaykqidarggnpelvalvkhlskmf