PDB entry 6c55

View 6c55 on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus Ketol-acid Reductosimerrase with hydroxyoxamate inhibitor 3
Class: oxidoreductase
Keywords: Ketol-acid reductoisomerase, inhibitor, OXIDOREDUCTASE
Deposited on 2018-01-14, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: ilvC, SAB1941
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c55a1, d6c55a2
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: ilvC, SAB1941
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c55b1, d6c55b2
  • Heterogens: MG, NAP, EKD, EKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c55A (A:)
    mttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedg
    fdvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppa
    dvdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragvie
    ttfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmye
    ggmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfke
    fyklreeqhghqiekvgrelremmpfiksksiekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c55A (A:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c55B (B:)
    mttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedg
    fdvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppa
    dvdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragvie
    ttfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmye
    ggmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfke
    fyklreeqhghqiekvgrelremmpfiksksiekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c55B (B:)
    ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
    dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
    vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
    tfkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyeg
    gmenvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkef
    yklreeqhghqiekvgrelremmpfi